BLASTX nr result
ID: Aconitum21_contig00015913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00015913 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223... 63 2e-08 ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2... 62 4e-08 emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] 62 4e-08 emb|CBI28265.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|XP_003518193.1| PREDICTED: aspartic proteinase nepenthesin-2... 61 1e-07 >ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223525662|gb|EEF28148.1| pepsin A, putative [Ricinus communis] Length = 468 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 348 SGGPAVILGNFQLQNFYVEYDLGNKRFGFKEQEC 247 S GPA+ILGNFQ QNFY+EYDL N RFGFKEQ C Sbjct: 434 SSGPAIILGNFQQQNFYIEYDLENDRFGFKEQSC 467 >ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 467 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 348 SGGPAVILGNFQLQNFYVEYDLGNKRFGFKEQECQ 244 SGGPA+ILGNFQ QNFYVEYDL N+R GF++Q C+ Sbjct: 433 SGGPAIILGNFQQQNFYVEYDLRNERLGFRQQSCK 467 >emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] Length = 454 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 348 SGGPAVILGNFQLQNFYVEYDLGNKRFGFKEQECQ 244 SGGPA+ILGNFQ QNFYVEYDL N+R GF++Q C+ Sbjct: 420 SGGPAIILGNFQQQNFYVEYDLRNERLGFRQQSCK 454 >emb|CBI28265.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 348 SGGPAVILGNFQLQNFYVEYDLGNKRFGFKEQEC 247 SGGPA+ILGNFQ QNFYVEYDL N+R GF++Q C Sbjct: 352 SGGPAIILGNFQQQNFYVEYDLRNERLGFRQQSC 385 >ref|XP_003518193.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 466 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 342 GPAVILGNFQLQNFYVEYDLGNKRFGFKEQECQ 244 GPAVILGN+Q QNFYVEYDL N+RFGF+ Q CQ Sbjct: 431 GPAVILGNYQQQNFYVEYDLENERFGFRSQSCQ 463