BLASTX nr result
ID: Aconitum21_contig00014845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00014845 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283617.2| PREDICTED: lariat debranching enzyme [Vitis ... 57 2e-06 ref|XP_002324932.1| predicted protein [Populus trichocarpa] gi|2... 56 5e-06 emb|CBI19325.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_002283617.2| PREDICTED: lariat debranching enzyme [Vitis vinifera] Length = 415 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -3 Query: 566 QTKSNGSFLGHCRNPQTESFLHLLGLPYLLDSTPESKEITCSPVSSISKE 417 Q+ SN F G+ RNPQTE L L LPYLLD+T ES++ T SP+S IS+E Sbjct: 338 QSASNSCFSGYHRNPQTELLLQFLELPYLLDNTLESRDPTHSPMSLISRE 387 >ref|XP_002324932.1| predicted protein [Populus trichocarpa] gi|222866366|gb|EEF03497.1| predicted protein [Populus trichocarpa] Length = 434 Score = 55.8 bits (133), Expect = 5e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -3 Query: 566 QTKSNGSFLGHCRNPQTESFLHLLGLPYLLDSTPESKEITCSPVSS 429 Q+ NGSF G RNPQTES L LL LPYLLDST ES+E SP +S Sbjct: 338 QSGPNGSFSGCPRNPQTESLLQLLELPYLLDSTSESREGRYSPSAS 383 >emb|CBI19325.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 55.1 bits (131), Expect = 8e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -3 Query: 566 QTKSNGSFLGHCRNPQTESFLHLLGLPYLLDSTPESKEITCSPVSSISK 420 Q+ SN F G+ RNPQTE L L LPYLLD+T ES++ T SP+S IS+ Sbjct: 338 QSASNSCFSGYHRNPQTELLLQFLELPYLLDNTLESRDPTHSPMSLISR 386