BLASTX nr result
ID: Aconitum21_contig00014155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00014155 (753 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278342.1| PREDICTED: F-box protein SKIP23 [Vitis vinif... 59 1e-06 ref|XP_002278304.1| PREDICTED: F-box protein SKIP23-like [Vitis ... 57 3e-06 ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus ... 57 3e-06 ref|XP_002528428.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 ref|XP_002313690.1| f-box family protein [Populus trichocarpa] g... 57 4e-06 >ref|XP_002278342.1| PREDICTED: F-box protein SKIP23 [Vitis vinifera] Length = 375 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/60 (45%), Positives = 37/60 (61%) Frame = +3 Query: 267 RTIKLKIFKLRQCCKCTNHGWERVKSIGDRAFFLGYNGSFSVSASEFLGCRPNSIYFTDN 446 R ++ K+FKL Q H W V+++GDR FLG +FS ASEF GC N IY+T++ Sbjct: 267 RAVRFKVFKLNQI----GHMWVEVENLGDRILFLGEKSTFSAVASEFCGCEGNCIYYTNS 322 >ref|XP_002278304.1| PREDICTED: F-box protein SKIP23-like [Vitis vinifera] Length = 394 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/62 (45%), Positives = 37/62 (59%) Frame = +3 Query: 258 RRYRTIKLKIFKLRQCCKCTNHGWERVKSIGDRAFFLGYNGSFSVSASEFLGCRPNSIYF 437 R R ++ K+FKL Q H W V+S+G+R FLG +FS ASEF GC N IY+ Sbjct: 265 RMKRAVRFKVFKLDQI----GHMWVEVESLGNRILFLGEKSTFSAVASEFCGCEGNCIYY 320 Query: 438 TD 443 T+ Sbjct: 321 TN 322 >ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551319|gb|EEF52805.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 398 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/61 (42%), Positives = 40/61 (65%) Frame = +3 Query: 264 YRTIKLKIFKLRQCCKCTNHGWERVKSIGDRAFFLGYNGSFSVSASEFLGCRPNSIYFTD 443 YRTI+ ++F+L W R+ ++GD+A F+G N S S+SA++F GC N IY+TD Sbjct: 290 YRTIRFEVFRL----DWNGPQWLRMSTLGDKALFIGENSSLSLSATDFSGCMGNCIYYTD 345 Query: 444 N 446 + Sbjct: 346 D 346 >ref|XP_002528428.1| conserved hypothetical protein [Ricinus communis] gi|223532164|gb|EEF33970.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = +3 Query: 267 RTIKLKIFKLRQCCKCTNHGWERVKSIGDRAFFLGYNGSFSVSASEFLGCRPNSIYFTDN 446 RT++ K+FKL + + W VKS+GDR FLG + +FS S S+ GC+ N I+F DN Sbjct: 226 RTVRFKVFKLDKEAQT----WIEVKSLGDRVLFLGDDSTFSASVSDLSGCKGNCIFFVDN 281 >ref|XP_002313690.1| f-box family protein [Populus trichocarpa] gi|222850098|gb|EEE87645.1| f-box family protein [Populus trichocarpa] Length = 410 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/60 (46%), Positives = 38/60 (63%) Frame = +3 Query: 267 RTIKLKIFKLRQCCKCTNHGWERVKSIGDRAFFLGYNGSFSVSASEFLGCRPNSIYFTDN 446 RT++ K+FKL + K W VK++ DR FLG + +FS SASE GC+ N I+F DN Sbjct: 287 RTVRFKVFKLNEEGK----SWIEVKNLEDRVLFLGDDSTFSASASELSGCKGNCIFFEDN 342