BLASTX nr result
ID: Aconitum21_contig00012797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00012797 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601315.1| hypothetical protein MTR_3g079340 [Medicago ... 59 3e-07 ref|XP_003630057.1| Glucan 1,3-beta-glucosidase [Medicago trunca... 56 3e-06 ref|XP_003596892.1| hypothetical protein MTR_2g087370 [Medicago ... 55 5e-06 >ref|XP_003601315.1| hypothetical protein MTR_3g079340 [Medicago truncatula] gi|355490363|gb|AES71566.1| hypothetical protein MTR_3g079340 [Medicago truncatula] Length = 707 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 350 KNQHGDAGYRSPYLSHAKRALYHLSYIPMI 439 K+Q GDAGYRSPYLSHAKRALYHLSYIP + Sbjct: 676 KDQIGDAGYRSPYLSHAKRALYHLSYIPFV 705 >ref|XP_003630057.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355524079|gb|AET04533.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] Length = 541 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +2 Query: 362 GDAGYRSPYLSHAKRALYHLSYIPMI 439 GDAGYRSPYLSHAKRALYHLSYIP++ Sbjct: 505 GDAGYRSPYLSHAKRALYHLSYIPIL 530 >ref|XP_003596892.1| hypothetical protein MTR_2g087370 [Medicago truncatula] gi|355485940|gb|AES67143.1| hypothetical protein MTR_2g087370 [Medicago truncatula] Length = 96 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +2 Query: 362 GDAGYRSPYLSHAKRALYHLSYIPM 436 GDAGYRSPYLSHAKRALYHLSYIP+ Sbjct: 63 GDAGYRSPYLSHAKRALYHLSYIPI 87