BLASTX nr result
ID: Aconitum21_contig00012683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00012683 (830 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512567.1| ATP-citrate synthase, putative [Ricinus comm... 49 4e-07 ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain ... 46 3e-06 ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain ... 46 3e-06 >ref|XP_002512567.1| ATP-citrate synthase, putative [Ricinus communis] gi|223548528|gb|EEF50019.1| ATP-citrate synthase, putative [Ricinus communis] Length = 423 Score = 49.3 bits (116), Expect(2) = 4e-07 Identities = 31/44 (70%), Positives = 32/44 (72%), Gaps = 5/44 (11%) Frame = -3 Query: 438 DFTELTIQETWLSSMMLVVKPDM-FDKL----LVAVN*DLAQVA 322 DFTELT QE WLSS LVVKPDM F K LVA+N DLAQVA Sbjct: 39 DFTELTNQEPWLSSSRLVVKPDMLFGKRGKSGLVALNLDLAQVA 82 Score = 31.2 bits (69), Expect(2) = 4e-07 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 2/25 (8%) Frame = -1 Query: 596 RKIKEYD--RLVREHLKILAGIQLE 528 +KI+EYD RL++EHLK LAG+ ++ Sbjct: 4 KKIREYDSKRLLKEHLKRLAGLDIQ 28 >ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 2 [Vitis vinifera] Length = 435 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = -3 Query: 438 DFTELTIQETWLSSMMLVVKPDM-FDKL----LVAVN*DLAQVA 322 DF ELT +E WLSS LVVKPDM F K LVA+N DLAQVA Sbjct: 51 DFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVA 94 Score = 31.6 bits (70), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 2/25 (8%) Frame = -1 Query: 596 RKIKEYD--RLVREHLKILAGIQLE 528 +KI+EYD RL+++HLK LAGI L+ Sbjct: 4 KKIREYDSKRLLKDHLKRLAGIDLQ 28 >ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 1 [Vitis vinifera] gi|296089834|emb|CBI39653.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = -3 Query: 438 DFTELTIQETWLSSMMLVVKPDM-FDKL----LVAVN*DLAQVA 322 DF ELT +E WLSS LVVKPDM F K LVA+N DLAQVA Sbjct: 39 DFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVA 82 Score = 31.6 bits (70), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 2/25 (8%) Frame = -1 Query: 596 RKIKEYD--RLVREHLKILAGIQLE 528 +KI+EYD RL+++HLK LAGI L+ Sbjct: 4 KKIREYDSKRLLKDHLKRLAGIDLQ 28