BLASTX nr result
ID: Aconitum21_contig00012538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00012538 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284037.1| PREDICTED: uncharacterized protein LOC100248... 63 5e-08 emb|CAN69364.1| hypothetical protein VITISV_006045 [Vitis vinifera] 63 5e-08 ref|XP_002314190.1| predicted protein [Populus trichocarpa] gi|2... 62 8e-08 ref|XP_004142748.1| PREDICTED: uncharacterized protein LOC101211... 61 1e-07 ref|XP_003633292.1| PREDICTED: uncharacterized protein LOC100249... 60 3e-07 >ref|XP_002284037.1| PREDICTED: uncharacterized protein LOC100248455 [Vitis vinifera] Length = 319 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 94 VFGCLFLALIAEIYYLLWWKKRITNREIEDD 2 VFGCL LAL+AE+YYLLWWKKRITNREIE D Sbjct: 14 VFGCLLLALVAELYYLLWWKKRITNREIEYD 44 >emb|CAN69364.1| hypothetical protein VITISV_006045 [Vitis vinifera] Length = 313 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 94 VFGCLFLALIAEIYYLLWWKKRITNREIEDD 2 VFGCL LAL+AE+YYLLWWKKRITNREIE D Sbjct: 14 VFGCLLLALVAELYYLLWWKKRITNREIEYD 44 >ref|XP_002314190.1| predicted protein [Populus trichocarpa] gi|222850598|gb|EEE88145.1| predicted protein [Populus trichocarpa] Length = 312 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 94 VFGCLFLALIAEIYYLLWWKKRITNREIEDD 2 VFGCL LA++AE+YYLLWWKKRI+NRE+E+D Sbjct: 14 VFGCLLLAIVAELYYLLWWKKRISNREVEED 44 >ref|XP_004142748.1| PREDICTED: uncharacterized protein LOC101211670 [Cucumis sativus] gi|449530974|ref|XP_004172466.1| PREDICTED: uncharacterized protein LOC101227394 [Cucumis sativus] Length = 323 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -2 Query: 94 VFGCLFLALIAEIYYLLWWKKRITNREIEDD 2 +FGCLFLAL+AE+YYLLWWKKR T+R++E+D Sbjct: 14 IFGCLFLALVAELYYLLWWKKRFTDRDVEND 44 >ref|XP_003633292.1| PREDICTED: uncharacterized protein LOC100249867 [Vitis vinifera] Length = 321 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 94 VFGCLFLALIAEIYYLLWWKKRITNREIEDD 2 VFGCL LAL+AE+YYLLWWKKR+T+ E+EDD Sbjct: 14 VFGCLLLALVAELYYLLWWKKRLTSTEMEDD 44