BLASTX nr result
ID: Aconitum21_contig00011433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00011433 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264382.1| PREDICTED: DNA damage response protein WSS1 ... 100 2e-19 emb|CAN76517.1| hypothetical protein VITISV_033675 [Vitis vinifera] 99 5e-19 ref|XP_002317357.1| predicted protein [Populus trichocarpa] gi|2... 94 9e-18 ref|XP_002522770.1| conserved hypothetical protein [Ricinus comm... 94 1e-17 ref|XP_002310948.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 >ref|XP_002264382.1| PREDICTED: DNA damage response protein WSS1 [Vitis vinifera] gi|296089891|emb|CBI39710.3| unnamed protein product [Vitis vinifera] Length = 366 Score = 99.8 bits (247), Expect = 2e-19 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +3 Query: 270 MNLGDLNKVWEIKPLKRPGEDEARKILERIAKQVQPIMKKHSWRVKLLSEFSP 428 MNLGDLNKVWE+KPLK+ GEDEARKILER+AK VQPIM+KH WRVKLLSEF P Sbjct: 1 MNLGDLNKVWEVKPLKKAGEDEARKILERVAKHVQPIMRKHKWRVKLLSEFCP 53 >emb|CAN76517.1| hypothetical protein VITISV_033675 [Vitis vinifera] Length = 354 Score = 98.6 bits (244), Expect = 5e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 270 MNLGDLNKVWEIKPLKRPGEDEARKILERIAKQVQPIMKKHSWRVKLLSEFSP 428 MNLGDLNKVWE++PLK+ GEDEARKILER+AK VQPIM+KH WRVKLLSEF P Sbjct: 1 MNLGDLNKVWEVRPLKKAGEDEARKILERVAKHVQPIMRKHKWRVKLLSEFCP 53 >ref|XP_002317357.1| predicted protein [Populus trichocarpa] gi|222860422|gb|EEE97969.1| predicted protein [Populus trichocarpa] Length = 388 Score = 94.4 bits (233), Expect = 9e-18 Identities = 42/53 (79%), Positives = 50/53 (94%) Frame = +3 Query: 270 MNLGDLNKVWEIKPLKRPGEDEARKILERIAKQVQPIMKKHSWRVKLLSEFSP 428 MNL DLNKVWEIK LK+PGE+EAR++L++IAKQVQPIM+KH+WRVKLLSEF P Sbjct: 1 MNLSDLNKVWEIKALKKPGEEEARRMLDKIAKQVQPIMRKHNWRVKLLSEFCP 53 >ref|XP_002522770.1| conserved hypothetical protein [Ricinus communis] gi|223538008|gb|EEF39621.1| conserved hypothetical protein [Ricinus communis] Length = 404 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/53 (77%), Positives = 50/53 (94%) Frame = +3 Query: 270 MNLGDLNKVWEIKPLKRPGEDEARKILERIAKQVQPIMKKHSWRVKLLSEFSP 428 MN+GDLNKVWEIK LK+PGE+EA+++LE+IAKQVQPIM+KH WRVK+LSEF P Sbjct: 1 MNVGDLNKVWEIKALKKPGEEEAKRMLEKIAKQVQPIMRKHKWRVKVLSEFCP 53 >ref|XP_002310948.1| predicted protein [Populus trichocarpa] gi|222850768|gb|EEE88315.1| predicted protein [Populus trichocarpa] Length = 331 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = +3 Query: 270 MNLGDLNKVWEIKPLKRPGEDEARKILERIAKQVQPIMKKHSWRVKLLSEFSP 428 M+L DLNKVWEIKPLK+ GE++ARK+LER+AKQVQPIMKK W+VK+LSEF P Sbjct: 1 MDLNDLNKVWEIKPLKKIGEEDARKVLERVAKQVQPIMKKRKWKVKILSEFCP 53