BLASTX nr result
ID: Aconitum21_contig00010999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00010999 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFZ78583.1| cellulose synthase-like protein [Populus tomentosa] 87 1e-15 ref|XP_002302382.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 gb|AFZ78584.1| cellulose synthase-like protein [Populus tomentosa] 86 3e-15 ref|XP_002307301.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 ref|XP_002510040.1| transferase, transferring glycosyl groups, p... 86 4e-15 >gb|AFZ78583.1| cellulose synthase-like protein [Populus tomentosa] Length = 701 Score = 87.0 bits (214), Expect = 1e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 343 MAPSFQWWAKESHRGTPVVVKMENPNWSMVELEGPSEEDF 462 MAPSF WWAK+SH+GTPVVVKMENPNWSMVELEGPSEEDF Sbjct: 1 MAPSFDWWAKDSHKGTPVVVKMENPNWSMVELEGPSEEDF 40 >ref|XP_002302382.1| predicted protein [Populus trichocarpa] gi|222844108|gb|EEE81655.1| predicted protein [Populus trichocarpa] Length = 701 Score = 87.0 bits (214), Expect = 1e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 343 MAPSFQWWAKESHRGTPVVVKMENPNWSMVELEGPSEEDF 462 MAPSF WWAK+SH+GTPVVVKMENPNWSMVELEGPSEEDF Sbjct: 1 MAPSFDWWAKDSHKGTPVVVKMENPNWSMVELEGPSEEDF 40 >gb|AFZ78584.1| cellulose synthase-like protein [Populus tomentosa] Length = 701 Score = 85.9 bits (211), Expect = 3e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 343 MAPSFQWWAKESHRGTPVVVKMENPNWSMVELEGPSEEDF 462 MAP F WWAK+SHRGTPVVVKMENPNWSMVELEGPSEEDF Sbjct: 1 MAPLFDWWAKDSHRGTPVVVKMENPNWSMVELEGPSEEDF 40 >ref|XP_002307301.1| predicted protein [Populus trichocarpa] gi|222856750|gb|EEE94297.1| predicted protein [Populus trichocarpa] Length = 701 Score = 85.9 bits (211), Expect = 3e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +1 Query: 343 MAPSFQWWAKESHRGTPVVVKMENPNWSMVELEGPSEEDF 462 MAP F WWAK+SHRGTPVVVKMENPNWSMVELEGPSEEDF Sbjct: 1 MAPLFDWWAKDSHRGTPVVVKMENPNWSMVELEGPSEEDF 40 >ref|XP_002510040.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223550741|gb|EEF52227.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 696 Score = 85.5 bits (210), Expect = 4e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 343 MAPSFQWWAKESHRGTPVVVKMENPNWSMVELEGPSEEDF 462 MAPSF WWAKE H+GTPVVVKMENPNWSMVELEGPS+EDF Sbjct: 1 MAPSFDWWAKEGHKGTPVVVKMENPNWSMVELEGPSDEDF 40