BLASTX nr result
ID: Aconitum21_contig00010894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00010894 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ... 80 2e-13 ref|XP_003529780.1| PREDICTED: probable cyclic nucleotide-gated ... 78 8e-13 ref|XP_003534111.1| PREDICTED: probable cyclic nucleotide-gated ... 76 2e-12 ref|XP_002524633.1| Cyclic nucleotide-gated ion channel, putativ... 71 1e-10 ref|XP_002334224.1| cyclic nucleotide-gated channel [Populus tri... 68 9e-10 >ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 772 Score = 79.7 bits (195), Expect = 2e-13 Identities = 45/80 (56%), Positives = 54/80 (67%), Gaps = 9/80 (11%) Frame = +1 Query: 241 MSGYEKDEIPMLSST--RLSDENTDVEPQRIRSRTRSASMSIPMHSIDSYESETRYVSHT 414 M+ +EKDE+PMLS T RLSDE D +R+ SRTRSAS+SIPM S++SYE ET V HT Sbjct: 1 MAHFEKDEVPMLSETHARLSDEVVDSNFRRLVSRTRSASISIPMASLESYEKETNLVGHT 60 Query: 415 G-------LPLTQMSDPLYS 453 G P QMS PLY+ Sbjct: 61 GPLRSVRKTPFVQMSGPLYA 80 >ref|XP_003529780.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 217 Score = 77.8 bits (190), Expect = 8e-13 Identities = 44/80 (55%), Positives = 54/80 (67%), Gaps = 9/80 (11%) Frame = +1 Query: 241 MSGYEKDEIPMLSST--RLSDENTDVEPQRIRSRTRSASMSIPMHSIDSYESETRYVSHT 414 M+ +EKDE+PMLS T +LSDE D +R+ SRTRSAS+SIPM S++SYE ET V HT Sbjct: 1 MAHFEKDEVPMLSETHAQLSDEVVDSSFRRLVSRTRSASISIPMASLESYEKETSLVGHT 60 Query: 415 G-------LPLTQMSDPLYS 453 G P QMS PLY+ Sbjct: 61 GPLCSVRKTPFVQMSGPLYA 80 >ref|XP_003534111.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 770 Score = 76.3 bits (186), Expect = 2e-12 Identities = 43/80 (53%), Positives = 54/80 (67%), Gaps = 9/80 (11%) Frame = +1 Query: 241 MSGYEKDEIPMLSST--RLSDENTDVEPQRIRSRTRSASMSIPMHSIDSYESETRYVSHT 414 M+ +EKDE+PMLS T +LSDE D +R+ SRT+SAS+SIPM S++SYE ET V HT Sbjct: 1 MAHFEKDEVPMLSETHAQLSDEVVDSNFRRLVSRTQSASISIPMASLESYEKETSLVGHT 60 Query: 415 G-------LPLTQMSDPLYS 453 G P QMS PLY+ Sbjct: 61 GPLRSVRKTPFVQMSGPLYA 80 >ref|XP_002524633.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223536102|gb|EEF37758.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 778 Score = 70.9 bits (172), Expect = 1e-10 Identities = 39/83 (46%), Positives = 54/83 (65%), Gaps = 9/83 (10%) Frame = +1 Query: 241 MSGYEKDEIPMLSST--RLSDENTDVEPQRIRSRTRSASMSIPMHSIDSYESETRYVSHT 414 M+ Y+KDE+PMLS +L DEN D Q SRT+SAS+SIPM++++SY +E V +T Sbjct: 1 MASYDKDEVPMLSDVHPQLLDENPDSRFQAFVSRTQSASISIPMNTMESYGNEANLVGYT 60 Query: 415 G-------LPLTQMSDPLYSNQK 462 G + QMS P+YSN+K Sbjct: 61 GPLRSERRAQMNQMSGPIYSNRK 83 >ref|XP_002334224.1| cyclic nucleotide-gated channel [Populus trichocarpa] gi|222869985|gb|EEF07116.1| cyclic nucleotide-gated channel [Populus trichocarpa] Length = 190 Score = 67.8 bits (164), Expect = 9e-10 Identities = 40/82 (48%), Positives = 51/82 (62%), Gaps = 9/82 (10%) Frame = +1 Query: 241 MSGYEKDEIPMLSST--RLSDENTDVEPQRIRSRTRSASMSIPMHSIDSYESETRYVSHT 414 M+ ++KD+IPMLS T + DEN D + SRT+SAS SIP+ S++SY SET V T Sbjct: 1 MANHDKDDIPMLSDTHPKSVDENVDSRFRPFLSRTQSASTSIPLDSMESYGSETNLVGFT 60 Query: 415 G-------LPLTQMSDPLYSNQ 459 G PL QMS PLY N+ Sbjct: 61 GPLRSARKAPLVQMSGPLYINR 82