BLASTX nr result
ID: Aconitum21_contig00010284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00010284 (541 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU27355.1| polygalacturonase inhibiting protein [Panax ginseng] 90 2e-16 ref|NP_188718.1| leucine-rich repeat-containing protein [Arabido... 86 3e-15 dbj|BAJ33628.1| unnamed protein product [Thellungiella halophila] 86 3e-15 ref|XP_002883270.1| leucine-rich repeat family protein [Arabidop... 86 3e-15 ref|XP_002285553.1| PREDICTED: DNA-damage-repair/toleration prot... 86 5e-15 >gb|ACU27355.1| polygalacturonase inhibiting protein [Panax ginseng] Length = 366 Score = 90.1 bits (222), Expect = 2e-16 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +1 Query: 4 IDLSYNKLRGPIPRSISAASYIGHLDLRDNHLCGQIPTGSPFDHLEA 144 +DLSYN+L+GPIP+SISAASY+GHLDL NHLCGQIP GSPFDHLEA Sbjct: 303 LDLSYNRLKGPIPKSISAASYVGHLDLSHNHLCGQIPVGSPFDHLEA 349 >ref|NP_188718.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|9294409|dbj|BAB02490.1| polygalacturonase inhibitor-like protein [Arabidopsis thaliana] gi|17380932|gb|AAL36278.1| unknown protein [Arabidopsis thaliana] gi|21436417|gb|AAM51409.1| unknown protein [Arabidopsis thaliana] gi|332642907|gb|AEE76428.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 365 Score = 86.3 bits (212), Expect = 3e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 4 IDLSYNKLRGPIPRSISAASYIGHLDLRDNHLCGQIPTGSPFDHLEA 144 +DLSYN L+GPIPRSIS AS+IGHLDL NHLCG+IP GSPFDHLEA Sbjct: 299 LDLSYNNLKGPIPRSISGASFIGHLDLSHNHLCGRIPVGSPFDHLEA 345 >dbj|BAJ33628.1| unnamed protein product [Thellungiella halophila] Length = 365 Score = 86.3 bits (212), Expect = 3e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 4 IDLSYNKLRGPIPRSISAASYIGHLDLRDNHLCGQIPTGSPFDHLEA 144 +DLSYN L+GPIPRSIS AS+IGHLDL NHLCG+IP GSPFDHLEA Sbjct: 299 LDLSYNNLKGPIPRSISGASFIGHLDLSHNHLCGRIPVGSPFDHLEA 345 >ref|XP_002883270.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297329110|gb|EFH59529.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 365 Score = 86.3 bits (212), Expect = 3e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 4 IDLSYNKLRGPIPRSISAASYIGHLDLRDNHLCGQIPTGSPFDHLEA 144 +DLSYN L+GPIPRSIS AS+IGHLDL NHLCG+IP GSPFDHLEA Sbjct: 299 LDLSYNNLKGPIPRSISGASFIGHLDLSHNHLCGRIPVGSPFDHLEA 345 >ref|XP_002285553.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Vitis vinifera] Length = 364 Score = 85.5 bits (210), Expect = 5e-15 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +1 Query: 4 IDLSYNKLRGPIPRSISAASYIGHLDLRDNHLCGQIPTGSPFDHLEA 144 +DLSYNKLRGPIP+S++ A+YIGHLDL NHLCG+IP GSPFDHLEA Sbjct: 301 LDLSYNKLRGPIPKSMAGAAYIGHLDLSHNHLCGRIPGGSPFDHLEA 347