BLASTX nr result
ID: Aconitum21_contig00010163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00010163 (482 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 70 2e-10 ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 68 9e-10 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 67 1e-09 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [S... 66 3e-09 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +1 Query: 127 MFLGQIPKRPNKEAALKQLKSHVAVFATYVAVVRASTYLLHYLYGEKSELKLEF 288 MF G ++P+K AALKQL+SHVA+F +VAV+R + Y+LHYL EK ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +1 Query: 127 MFLGQIPKRPNKEAALKQLKSHVAVFATYVAVVRASTYLLHYLYGEKSELKLEF 288 MF G ++P+K ALKQLKSHVA+F +V V+R + Y+LHYL EK ELKLEF Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLEF 54 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|356545339|ref|XP_003541101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 2 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +1 Query: 127 MFLGQIPKRPNKEAALKQLKSHVAVFATYVAVVRASTYLLHYLYGEKSELKLE 285 MF G ++P+K AALKQLKSH A+F T+V V+R + Y+LH+L EK ELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLE 53 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = +1 Query: 127 MFLGQIPKRPNKEAALKQLKSHVAVFATYVAVVRASTYLLHYLYGEKSELKLEF 288 MF G ++P+K AALKQLK+H A+F +VA++R + Y+LHYL +K ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] gi|241920642|gb|EER93786.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] Length = 56 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = +1 Query: 127 MFLGQIPKRPNKEAALKQLKSHVAVFATYVAVVRASTYLLHYLY--GEKSELKLE 285 MFLG +P+RP+KEAA KQL+SH+ + A+ AV+RA+ Y+LH+L G+ ELKLE Sbjct: 1 MFLGAVPRRPSKEAAYKQLRSHLVIMASCAAVIRAAPYILHFLTRDGDVQELKLE 55