BLASTX nr result
ID: Aconitum21_contig00008692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00008692 (471 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246... 67 1e-09 emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] 67 1e-09 >ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246918 [Vitis vinifera] Length = 604 Score = 67.4 bits (163), Expect = 1e-09 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = +1 Query: 268 MTGGSLGQRALSYGSLQHTQNSVVLPFHATPIAL-RKPAKMLLSGPRDKEKIASRIFKIA 444 MTGG LG R+ SYGSLQH QN FH P + RKP+KML SG R+KE++ +F+ Sbjct: 1 MTGGLLGLRSGSYGSLQHLQNGA---FHPQPQFVGRKPSKMLPSGSREKERLLPYLFRFL 57 Query: 445 SRWRVGMLL 471 SR RVGML+ Sbjct: 58 SRRRVGMLI 66 >emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera] Length = 616 Score = 67.4 bits (163), Expect = 1e-09 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = +1 Query: 268 MTGGSLGQRALSYGSLQHTQNSVVLPFHATPIAL-RKPAKMLLSGPRDKEKIASRIFKIA 444 MTGG LG R+ SYGSLQH QN FH P + RKP+KML SG R+KE++ +F+ Sbjct: 1 MTGGLLGLRSGSYGSLQHLQNGA---FHPQPQFVGRKPSKMLPSGSREKERLLPYLFRFL 57 Query: 445 SRWRVGMLL 471 SR RVGML+ Sbjct: 58 SRRRVGMLI 66