BLASTX nr result
ID: Aconitum21_contig00007989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00007989 (570 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330362.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 ref|XP_004143082.1| PREDICTED: sucrose nonfermenting 4-like prot... 68 9e-10 gb|AAG10141.1|AF250335_1 putative activator subunit of SNF1-rela... 68 9e-10 ref|NP_563834.1| sucrose nonfermenting 4-like protein [Arabidops... 68 9e-10 ref|XP_003554657.1| PREDICTED: sucrose nonfermenting 4-like prot... 68 9e-10 >ref|XP_002330362.1| predicted protein [Populus trichocarpa] gi|222871566|gb|EEF08697.1| predicted protein [Populus trichocarpa] Length = 464 Score = 69.3 bits (168), Expect = 4e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 568 MERLANPGVRRVIIVEAGSKRVEGIVTLSDVFKFLLG 458 MERLANPGVRR++IVEAGSKRVEGIVTL D+FKFLLG Sbjct: 428 MERLANPGVRRLVIVEAGSKRVEGIVTLRDIFKFLLG 464 >ref|XP_004143082.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus] gi|449523153|ref|XP_004168589.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus] Length = 491 Score = 68.2 bits (165), Expect = 9e-10 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -3 Query: 568 MERLANPGVRRVIIVEAGSKRVEGIVTLSDVFKFLLG 458 M+RLANPGVRR++IVEAGSKRVEGI++LSD+FKFLLG Sbjct: 455 MDRLANPGVRRLVIVEAGSKRVEGIISLSDIFKFLLG 491 >gb|AAG10141.1|AF250335_1 putative activator subunit of SNF1-related protein kinase SNF4 [Arabidopsis thaliana] Length = 382 Score = 68.2 bits (165), Expect = 9e-10 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -3 Query: 568 MERLANPGVRRVIIVEAGSKRVEGIVTLSDVFKFLLG 458 MERLANPGVRR++IVEAGSKRVEGI++LSDVF+FLLG Sbjct: 345 MERLANPGVRRLVIVEAGSKRVEGIISLSDVFQFLLG 381 >ref|NP_563834.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] gi|75249553|sp|Q944A6.1|SNF4_ARATH RecName: Full=Sucrose nonfermenting 4-like protein; Short=SNF4; AltName: Full=CBS domain-containing protein CBSCBS3; AltName: Full=SNF1-related protein kinase regulatory subunit betagamma; Short=AKIN subunit betagamma; Short=AKINbetagamma gi|16612255|gb|AAL27498.1|AF439826_1 At1g09020/F7G19_11 [Arabidopsis thaliana] gi|23308443|gb|AAN18191.1| At1g09020/F7G19_11 [Arabidopsis thaliana] gi|75037070|gb|ABA12450.1| AKINbetagamma [Arabidopsis thaliana] gi|332190262|gb|AEE28383.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] Length = 487 Score = 68.2 bits (165), Expect = 9e-10 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -3 Query: 568 MERLANPGVRRVIIVEAGSKRVEGIVTLSDVFKFLLG 458 MERLANPGVRR++IVEAGSKRVEGI++LSDVF+FLLG Sbjct: 450 MERLANPGVRRLVIVEAGSKRVEGIISLSDVFQFLLG 486 >ref|XP_003554657.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 2 [Glycine max] Length = 488 Score = 68.2 bits (165), Expect = 9e-10 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -3 Query: 568 MERLANPGVRRVIIVEAGSKRVEGIVTLSDVFKFLLG 458 MERLANPGVRR+++VEAGSKRVEGI++LSDVF+FLLG Sbjct: 452 MERLANPGVRRLVVVEAGSKRVEGIISLSDVFRFLLG 488