BLASTX nr result
ID: Aconitum21_contig00007974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00007974 (2092 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310021.1| predicted protein [Populus trichocarpa] gi|2... 86 5e-14 ref|XP_002528674.1| conserved hypothetical protein [Ricinus comm... 83 3e-13 ref|NP_974759.1| uncharacterized protein [Arabidopsis thaliana] ... 82 6e-13 ref|NP_974760.1| uncharacterized protein [Arabidopsis thaliana] ... 82 6e-13 ref|NP_568225.1| uncharacterized protein [Arabidopsis thaliana] ... 82 6e-13 >ref|XP_002310021.1| predicted protein [Populus trichocarpa] gi|222852924|gb|EEE90471.1| predicted protein [Populus trichocarpa] Length = 204 Score = 85.5 bits (210), Expect = 5e-14 Identities = 46/55 (83%), Positives = 48/55 (87%) Frame = +2 Query: 689 LFLLAIPTLLGCRRAAEWLEMLMDVRREELPDTMAAVRLSGMEISNLTMELSDQG 853 LFL AIPTLL +RAAE LE LMDV REELPDTMAAVRLSGMEIS+LTMELSD G Sbjct: 61 LFLSAIPTLLAFKRAAESLEKLMDVTREELPDTMAAVRLSGMEISDLTMELSDLG 115 >ref|XP_002528674.1| conserved hypothetical protein [Ricinus communis] gi|223531897|gb|EEF33713.1| conserved hypothetical protein [Ricinus communis] Length = 273 Score = 82.8 bits (203), Expect = 3e-13 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +2 Query: 689 LFLLAIPTLLGCRRAAEWLEMLMDVRREELPDTMAAVRLSGMEISNLTMELSDQG 853 LF+ AIPTLL +RAAE LE LMD REELPDTMAA+RLSGMEIS+LTMELSD G Sbjct: 124 LFISAIPTLLAFKRAAESLEKLMDATREELPDTMAAIRLSGMEISDLTMELSDLG 178 >ref|NP_974759.1| uncharacterized protein [Arabidopsis thaliana] gi|332004094|gb|AED91477.1| uncharacterized protein [Arabidopsis thaliana] Length = 257 Score = 82.0 bits (201), Expect = 6e-13 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +2 Query: 689 LFLLAIPTLLGCRRAAEWLEMLMDVRREELPDTMAAVRLSGMEISNLTMELSDQG 853 LF AIPTLL ++AAE LE L+DV REELPDTMAAVRLSGMEIS+LTMELSD G Sbjct: 113 LFFAAIPTLLAFKKAAESLEKLLDVTREELPDTMAAVRLSGMEISDLTMELSDLG 167 >ref|NP_974760.1| uncharacterized protein [Arabidopsis thaliana] gi|332004095|gb|AED91478.1| uncharacterized protein [Arabidopsis thaliana] Length = 256 Score = 82.0 bits (201), Expect = 6e-13 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +2 Query: 689 LFLLAIPTLLGCRRAAEWLEMLMDVRREELPDTMAAVRLSGMEISNLTMELSDQG 853 LF AIPTLL ++AAE LE L+DV REELPDTMAAVRLSGMEIS+LTMELSD G Sbjct: 113 LFFAAIPTLLAFKKAAESLEKLLDVTREELPDTMAAVRLSGMEISDLTMELSDLG 167 >ref|NP_568225.1| uncharacterized protein [Arabidopsis thaliana] gi|26453006|dbj|BAC43579.1| unknown protein [Arabidopsis thaliana] gi|28973017|gb|AAO63833.1| unknown protein [Arabidopsis thaliana] gi|332004096|gb|AED91479.1| uncharacterized protein [Arabidopsis thaliana] Length = 205 Score = 82.0 bits (201), Expect = 6e-13 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +2 Query: 689 LFLLAIPTLLGCRRAAEWLEMLMDVRREELPDTMAAVRLSGMEISNLTMELSDQG 853 LF AIPTLL ++AAE LE L+DV REELPDTMAAVRLSGMEIS+LTMELSD G Sbjct: 113 LFFAAIPTLLAFKKAAESLEKLLDVTREELPDTMAAVRLSGMEISDLTMELSDLG 167