BLASTX nr result
ID: Aconitum21_contig00007822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00007822 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513044.1| Aspartic proteinase nepenthesin-1 precursor,... 63 3e-08 ref|XP_003546713.1| PREDICTED: LOW QUALITY PROTEIN: aspartic pro... 61 1e-07 ref|NP_001241567.1| uncharacterized protein LOC100819698 precurs... 61 1e-07 ref|XP_004142420.1| PREDICTED: aspartic proteinase nepenthesin-1... 59 4e-07 gb|AFK35790.1| unknown [Medicago truncatula] 59 4e-07 >ref|XP_002513044.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus communis] gi|223548055|gb|EEF49547.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus communis] Length = 431 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -3 Query: 126 HRTARSITYLAMEVAPDIVNSMLNVIANMQQYNHIILFDVP 4 H TA SIT LAM APD VNS+LNVIANMQQ NH ILFDVP Sbjct: 379 HSTASSITCLAMAAAPDNVNSVLNVIANMQQQNHRILFDVP 419 >ref|XP_003546713.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase nepenthesin-1-like [Glycine max] Length = 444 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 126 HRTARSITYLAMEVAPDIVNSMLNVIANMQQYNHIILFDVP 4 H TA S+T LAM APD VNS+LNVIANMQQ NH +LFDVP Sbjct: 392 HSTAGSVTCLAMAPAPDNVNSVLNVIANMQQQNHRVLFDVP 432 >ref|NP_001241567.1| uncharacterized protein LOC100819698 precursor [Glycine max] gi|255638149|gb|ACU19388.1| unknown [Glycine max] Length = 437 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 126 HRTARSITYLAMEVAPDIVNSMLNVIANMQQYNHIILFDVP 4 H TA S+T LAM APD VNS+LNVIANMQQ NH +LFDVP Sbjct: 385 HSTAGSVTCLAMAPAPDNVNSVLNVIANMQQQNHRVLFDVP 425 >ref|XP_004142420.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus] Length = 441 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -3 Query: 135 YIDHRTARSITYLAMEVAPDIVNSMLNVIANMQQYNHIILFDVP 4 ++ H TA S T LAM APD VNS+LNVIA+MQQ NH ILFD+P Sbjct: 385 FLIHSTAGSTTCLAMAAAPDNVNSVLNVIASMQQQNHRILFDIP 428 >gb|AFK35790.1| unknown [Medicago truncatula] Length = 434 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 126 HRTARSITYLAMEVAPDIVNSMLNVIANMQQYNHIILFDVP 4 H TA S T LAM APD VNS+LNVIANMQQ NH +LFDVP Sbjct: 382 HSTAGSTTCLAMAGAPDNVNSVLNVIANMQQQNHRVLFDVP 422