BLASTX nr result
ID: Aconitum21_contig00007723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00007723 (725 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFD02178.1| putative kelch repeat containing F-box protein [P... 56 9e-06 >gb|AFD02178.1| putative kelch repeat containing F-box protein [Persicaria minor] Length = 487 Score = 55.8 bits (133), Expect = 9e-06 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -2 Query: 559 MLEERPCLVSRALRSSCGQDTKWVYMTYHF-MEVPHGKRRFDDEGEEELFGKRRSSK 392 MLE+ CLVSRAL+SSC Q++KW Y V GKR D E EEE G R+S+K Sbjct: 1 MLEDHSCLVSRALQSSCEQESKWPYAKCGLEAVVSKGKRPLDSEAEEEESGSRKSAK 57