BLASTX nr result
ID: Aconitum21_contig00007656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00007656 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002878710.1| hypothetical protein ARALYDRAFT_900881 [Arab... 114 8e-24 gb|AAM61727.1| unknown [Arabidopsis thaliana] 114 8e-24 ref|NP_565558.1| uncharacterized protein [Arabidopsis thaliana] ... 113 2e-23 dbj|BAC42221.1| unknown protein [Arabidopsis thaliana] 113 2e-23 ref|XP_002869375.1| hypothetical protein ARALYDRAFT_353759 [Arab... 112 3e-23 >ref|XP_002878710.1| hypothetical protein ARALYDRAFT_900881 [Arabidopsis lyrata subsp. lyrata] gi|297324549|gb|EFH54969.1| hypothetical protein ARALYDRAFT_900881 [Arabidopsis lyrata subsp. lyrata] Length = 173 Score = 114 bits (285), Expect = 8e-24 Identities = 49/62 (79%), Positives = 58/62 (93%) Frame = -3 Query: 445 STGGVCGYLHDLIYITCFVQLMSILSGKFWYTYLVIPAFGIYQISGLLKGFLSHGSEGEV 266 +TGG+CGYLHD+IYITCFVQL SI+SGKFWYTYLVIPAFG+Y+ SGL++GF+S GSEG V Sbjct: 87 TTGGICGYLHDVIYITCFVQLASIISGKFWYTYLVIPAFGVYKASGLIRGFMSQGSEGGV 146 Query: 265 ED 260 ED Sbjct: 147 ED 148 >gb|AAM61727.1| unknown [Arabidopsis thaliana] Length = 173 Score = 114 bits (285), Expect = 8e-24 Identities = 49/62 (79%), Positives = 58/62 (93%) Frame = -3 Query: 445 STGGVCGYLHDLIYITCFVQLMSILSGKFWYTYLVIPAFGIYQISGLLKGFLSHGSEGEV 266 +TGG+CGYLHD+IYITCFVQL SI+SGKFWYTYLVIPAFG+Y+ SGL++GF+S GSEG V Sbjct: 87 TTGGICGYLHDVIYITCFVQLASIISGKFWYTYLVIPAFGVYKASGLIRGFMSQGSEGGV 146 Query: 265 ED 260 ED Sbjct: 147 ED 148 >ref|NP_565558.1| uncharacterized protein [Arabidopsis thaliana] gi|3738323|gb|AAC63664.1| expressed protein [Arabidopsis thaliana] gi|21805668|gb|AAM76748.1| hypothetical protein [Arabidopsis thaliana] gi|55740573|gb|AAV63879.1| hypothetical protein [Arabidopsis thaliana] gi|330252411|gb|AEC07505.1| uncharacterized protein [Arabidopsis thaliana] Length = 173 Score = 113 bits (282), Expect = 2e-23 Identities = 48/62 (77%), Positives = 58/62 (93%) Frame = -3 Query: 445 STGGVCGYLHDLIYITCFVQLMSILSGKFWYTYLVIPAFGIYQISGLLKGFLSHGSEGEV 266 +TGG+CGYLHD+IYITCFVQL SI++GKFWYTYLVIPAFG+Y+ SGL++GF+S GSEG V Sbjct: 87 TTGGICGYLHDVIYITCFVQLASIITGKFWYTYLVIPAFGVYKASGLIRGFMSQGSEGGV 146 Query: 265 ED 260 ED Sbjct: 147 ED 148 >dbj|BAC42221.1| unknown protein [Arabidopsis thaliana] Length = 173 Score = 113 bits (282), Expect = 2e-23 Identities = 48/62 (77%), Positives = 58/62 (93%) Frame = -3 Query: 445 STGGVCGYLHDLIYITCFVQLMSILSGKFWYTYLVIPAFGIYQISGLLKGFLSHGSEGEV 266 +TGG+CGYLHD+IYITCFVQL SI++GKFWYTYLVIPAFG+Y+ SGL++GF+S GSEG V Sbjct: 87 TTGGICGYLHDVIYITCFVQLASIITGKFWYTYLVIPAFGVYKASGLIRGFMSQGSEGGV 146 Query: 265 ED 260 ED Sbjct: 147 ED 148 >ref|XP_002869375.1| hypothetical protein ARALYDRAFT_353759 [Arabidopsis lyrata subsp. lyrata] gi|297315211|gb|EFH45634.1| hypothetical protein ARALYDRAFT_353759 [Arabidopsis lyrata subsp. lyrata] Length = 173 Score = 112 bits (280), Expect = 3e-23 Identities = 50/62 (80%), Positives = 56/62 (90%) Frame = -3 Query: 445 STGGVCGYLHDLIYITCFVQLMSILSGKFWYTYLVIPAFGIYQISGLLKGFLSHGSEGEV 266 STGG+CGYLHD++YITCFVQL SI+SGKFWY YLVIPAFG Y+ SGL+KG LSHGSEG V Sbjct: 87 STGGMCGYLHDVLYITCFVQLGSIISGKFWYAYLVIPAFGAYKASGLIKGLLSHGSEGGV 146 Query: 265 ED 260 ED Sbjct: 147 ED 148