BLASTX nr result
ID: Aconitum21_contig00006470
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00006470 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula... 56 3e-06 >ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula] gi|355497985|gb|AES79188.1| Pantothenate synthetase [Medicago truncatula] Length = 551 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/72 (40%), Positives = 45/72 (62%), Gaps = 1/72 (1%) Frame = -2 Query: 315 FIYFNCESVSV*SLCMWKVLFHATIRVIWNERNRRIFEEVFSTSERMIDQIKMLVWSW-L 139 F +N E+ S L +++++HATI +IW ERN +IF+ F + +ID+IK+L W W L Sbjct: 339 FESWNGEATSKRLLKGFRLIWHATIWLIWKERNAKIFKNQFKEVDEIIDEIKVLSWFWVL 398 Query: 138 SGKPAFKCLFFD 103 S CLF++ Sbjct: 399 SRLKIASCLFYE 410