BLASTX nr result
ID: Aconitum21_contig00006329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00006329 (802 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAQ53097.1| basic-leucine zipper [Humulus lupulus] 60 6e-07 >emb|CAQ53097.1| basic-leucine zipper [Humulus lupulus] Length = 314 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +2 Query: 2 EENSRLQSEKAERNKERYDQLMEKLIPVEEKKKAEAPPVGVLRKSKSSQW 151 EEN RL EKAER KER+ QLMEK+IPVEEK++ P VLR+ +S QW Sbjct: 269 EENDRLLKEKAERTKERFKQLMEKVIPVEEKRR----PPRVLRRVRSLQW 314