BLASTX nr result
ID: Aconitum21_contig00005966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00005966 (1424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276691.1| PREDICTED: putative RNA-binding protein Luc7... 61 6e-07 emb|CAN71034.1| hypothetical protein VITISV_000356 [Vitis vinifera] 61 6e-07 ref|XP_004138908.1| PREDICTED: putative RNA-binding protein Luc7... 60 1e-06 ref|XP_003534502.1| PREDICTED: putative RNA-binding protein Luc7... 60 1e-06 ref|XP_003624200.1| Luc7-like protein [Medicago truncatula] gi|3... 60 1e-06 >ref|XP_002276691.1| PREDICTED: putative RNA-binding protein Luc7-like 2 [Vitis vinifera] gi|297735244|emb|CBI17606.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 61.2 bits (147), Expect = 6e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +3 Query: 714 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 842 +DVC LF VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLFLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >emb|CAN71034.1| hypothetical protein VITISV_000356 [Vitis vinifera] Length = 419 Score = 61.2 bits (147), Expect = 6e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +3 Query: 714 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 842 +DVC LF VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLFLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_004138908.1| PREDICTED: putative RNA-binding protein Luc7-like 2-like [Cucumis sativus] gi|449506274|ref|XP_004162701.1| PREDICTED: putative RNA-binding protein Luc7-like 2-like [Cucumis sativus] Length = 413 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 714 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 842 +DVC +F VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRMFLVGLCPHELFQLTKMDMGPCPKIHSLQLRKEYEEGK 72 >ref|XP_003534502.1| PREDICTED: putative RNA-binding protein Luc7-like 2-like [Glycine max] Length = 414 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 714 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 842 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72 >ref|XP_003624200.1| Luc7-like protein [Medicago truncatula] gi|355499215|gb|AES80418.1| Luc7-like protein [Medicago truncatula] Length = 410 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 714 QDVCCLFFVGLYSRELIQTTKIDMGPCPKLYPLQLRNQYQEEK 842 +DVC L+ VGL EL Q TK+DMGPCPK++ LQLR +Y+E K Sbjct: 30 RDVCRLYLVGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAK 72