BLASTX nr result
ID: Aconitum21_contig00005388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00005388 (686 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26319.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002279408.1| PREDICTED: protein argonaute 10-like [Vitis ... 80 3e-13 gb|AFV15389.1| AGO10A splice variant 2 [Solanum lycopersicum] 79 8e-13 ref|XP_004134114.1| PREDICTED: protein argonaute 10-like [Cucumi... 77 2e-12 emb|CAA11429.1| Zwille protein [Arabidopsis thaliana] 77 2e-12 >emb|CBI26319.3| unnamed protein product [Vitis vinifera] Length = 953 Score = 80.5 bits (197), Expect = 3e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 684 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIRN 574 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIR+ Sbjct: 722 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIRD 758 >ref|XP_002279408.1| PREDICTED: protein argonaute 10-like [Vitis vinifera] Length = 995 Score = 80.5 bits (197), Expect = 3e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 684 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIRN 574 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIR+ Sbjct: 741 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIRD 777 >gb|AFV15389.1| AGO10A splice variant 2 [Solanum lycopersicum] Length = 959 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 684 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIRN 574 YAGLVCAQAHRQELIQDLYKTWHDP RGTVSGGMIR+ Sbjct: 710 YAGLVCAQAHRQELIQDLYKTWHDPARGTVSGGMIRD 746 >ref|XP_004134114.1| PREDICTED: protein argonaute 10-like [Cucumis sativus] gi|449523115|ref|XP_004168570.1| PREDICTED: protein argonaute 10-like [Cucumis sativus] Length = 984 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 684 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIRN 574 YAGLVCAQAHRQELIQDLYKTW DPVRGTVSGGMIR+ Sbjct: 735 YAGLVCAQAHRQELIQDLYKTWQDPVRGTVSGGMIRD 771 >emb|CAA11429.1| Zwille protein [Arabidopsis thaliana] Length = 988 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 684 YAGLVCAQAHRQELIQDLYKTWHDPVRGTVSGGMIRN 574 YAGLVCAQAHRQELIQDLYKTW DPVRGTVSGGMIR+ Sbjct: 738 YAGLVCAQAHRQELIQDLYKTWQDPVRGTVSGGMIRD 774