BLASTX nr result
ID: Aconitum21_contig00005062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00005062 (795 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB88668.1| histone H2B [Cicer arietinum] 67 4e-09 ref|XP_003521344.1| PREDICTED: histone H2B.4-like [Glycine max] 66 8e-09 ref|XP_003542467.1| PREDICTED: histone H2B.4 [Glycine max] 66 8e-09 ref|NP_001236239.1| uncharacterized protein LOC100500314 [Glycin... 66 8e-09 ref|XP_003625510.1| Histone H2B [Medicago truncatula] gi|1088607... 66 8e-09 >emb|CAB88668.1| histone H2B [Cicer arietinum] Length = 139 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 640 LTQSGSPETIHDSIKKSIETYKIYIFKVLKQVHPDIGISSKAMGI 506 +++ G+ + +KKS+ETYKIYIFKVLKQVHPDIGISSKAMGI Sbjct: 32 ISKEGTSDKKKKRVKKSVETYKIYIFKVLKQVHPDIGISSKAMGI 76 >ref|XP_003521344.1| PREDICTED: histone H2B.4-like [Glycine max] Length = 138 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -3 Query: 640 LTQSGSPETIHDSIKKSIETYKIYIFKVLKQVHPDIGISSKAMGI 506 +++ G E KKS+ETYKIYIFKVLKQVHPDIGISSKAMGI Sbjct: 31 ISKEGGSEKKKKRTKKSVETYKIYIFKVLKQVHPDIGISSKAMGI 75 >ref|XP_003542467.1| PREDICTED: histone H2B.4 [Glycine max] Length = 139 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -3 Query: 640 LTQSGSPETIHDSIKKSIETYKIYIFKVLKQVHPDIGISSKAMGI 506 +++ G E KKS+ETYKIYIFKVLKQVHPDIGISSKAMGI Sbjct: 32 ISKEGGSEKKKKRTKKSVETYKIYIFKVLKQVHPDIGISSKAMGI 76 >ref|NP_001236239.1| uncharacterized protein LOC100500314 [Glycine max] gi|255630000|gb|ACU15352.1| unknown [Glycine max] Length = 138 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -3 Query: 640 LTQSGSPETIHDSIKKSIETYKIYIFKVLKQVHPDIGISSKAMGI 506 +++ G E KKS+ETYKIYIFKVLKQVHPDIGISSKAMGI Sbjct: 31 ISKEGGSEKKKKRTKKSVETYKIYIFKVLKQVHPDIGISSKAMGI 75 >ref|XP_003625510.1| Histone H2B [Medicago truncatula] gi|108860774|sp|Q1SU99.3|H2B3_MEDTR RecName: Full=Probable histone H2B.3 gi|217071474|gb|ACJ84097.1| unknown [Medicago truncatula] gi|355500525|gb|AES81728.1| Histone H2B [Medicago truncatula] gi|388510844|gb|AFK43488.1| unknown [Medicago truncatula] Length = 138 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 640 LTQSGSPETIHDSIKKSIETYKIYIFKVLKQVHPDIGISSKAMGI 506 +++ GS + KKS+ETYKIYIFKVLKQVHPDIG+SSKAMGI Sbjct: 31 ISKEGSSDKKKKRTKKSVETYKIYIFKVLKQVHPDIGVSSKAMGI 75