BLASTX nr result
ID: Aconitum21_contig00004863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00004863 (631 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arab... 109 4e-22 ref|XP_002328908.1| predicted protein [Populus trichocarpa] gi|2... 109 4e-22 gb|AAN60250.1| unknown [Arabidopsis thaliana] 109 4e-22 ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis th... 109 4e-22 ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricin... 108 6e-22 >ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. lyrata] gi|297329305|gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. lyrata] Length = 461 Score = 109 bits (273), Expect = 4e-22 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -3 Query: 629 IKMPRNGDVPYTHANVSLAYRDFGYKPTTDLASGLRKFAKWYVGYYGIDARVKK 468 IKMPRNGDVPYTHANVSLAY+DFGYKPTTDLA+GLRKF KWYVGYYGI RVKK Sbjct: 399 IKMPRNGDVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKK 452 >ref|XP_002328908.1| predicted protein [Populus trichocarpa] gi|222839338|gb|EEE77675.1| predicted protein [Populus trichocarpa] Length = 456 Score = 109 bits (273), Expect = 4e-22 Identities = 50/61 (81%), Positives = 54/61 (88%) Frame = -3 Query: 629 IKMPRNGDVPYTHANVSLAYRDFGYKPTTDLASGLRKFAKWYVGYYGIDARVKKASESSV 450 IKMPRNGDVPYTHANV+LAYRDFGYKPTTDLA+GLRKF KWYV YYGI RVKK S+ + Sbjct: 390 IKMPRNGDVPYTHANVTLAYRDFGYKPTTDLATGLRKFVKWYVDYYGIQTRVKKDSDINS 449 Query: 449 E 447 E Sbjct: 450 E 450 >gb|AAN60250.1| unknown [Arabidopsis thaliana] Length = 460 Score = 109 bits (273), Expect = 4e-22 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -3 Query: 629 IKMPRNGDVPYTHANVSLAYRDFGYKPTTDLASGLRKFAKWYVGYYGIDARVKK 468 IKMPRNGDVPYTHANVSLAY+DFGYKPTTDLA+GLRKF KWYVGYYGI RVKK Sbjct: 398 IKMPRNGDVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKK 451 >ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana] gi|75311206|sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic acid epimerase 6; Short=AtUGlcAE2 gi|13877895|gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana] gi|9294651|dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana] gi|15810205|gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana] gi|17065098|gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana] gi|22136952|gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana] gi|59668636|emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana] gi|332643297|gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana] gi|385137880|gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana] Length = 460 Score = 109 bits (273), Expect = 4e-22 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -3 Query: 629 IKMPRNGDVPYTHANVSLAYRDFGYKPTTDLASGLRKFAKWYVGYYGIDARVKK 468 IKMPRNGDVPYTHANVSLAY+DFGYKPTTDLA+GLRKF KWYVGYYGI RVKK Sbjct: 398 IKMPRNGDVPYTHANVSLAYKDFGYKPTTDLAAGLRKFVKWYVGYYGIQPRVKK 451 >ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] gi|223538048|gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] Length = 401 Score = 108 bits (271), Expect = 6e-22 Identities = 48/61 (78%), Positives = 54/61 (88%) Frame = -3 Query: 629 IKMPRNGDVPYTHANVSLAYRDFGYKPTTDLASGLRKFAKWYVGYYGIDARVKKASESSV 450 IKMPRNGDVPYTHANVSLAY+DFGYKPTTDL+SGLRKF KWYVGYYGI +VK ++ + Sbjct: 337 IKMPRNGDVPYTHANVSLAYKDFGYKPTTDLSSGLRKFVKWYVGYYGIQTKVKTQNDINT 396 Query: 449 E 447 E Sbjct: 397 E 397