BLASTX nr result
ID: Aconitum21_contig00004646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00004646 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera] 64 1e-08 ref|NP_173228.1| kunitz type trypsin and protease inhibitor doma... 62 4e-08 gb|AFK41478.1| unknown [Medicago truncatula] 62 5e-08 ref|XP_003620188.1| Miraculin [Medicago truncatula] gi|355495203... 62 5e-08 ref|NP_001238098.1| uncharacterized protein LOC100306134 precurs... 62 6e-08 >emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera] Length = 203 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +1 Query: 139 FDELAQRWFVTSGGIEGNPSRQTLDNWFKIEEHAITKVCIKNIHKSIQICPNVYNYCK-V 315 +DE + +WFVT+GG+EGNP R+TLDNWFKIE++ ++ +K + CP V ++CK V Sbjct: 123 YDESSGQWFVTTGGVEGNPGRETLDNWFKIEKY-------EDDYKLV-FCPTVCDFCKPV 174 Query: 316 C 318 C Sbjct: 175 C 175 >ref|NP_173228.1| kunitz type trypsin and protease inhibitor domain-containing protein [Arabidopsis thaliana] gi|9665064|gb|AAF97266.1|AC034106_9 Contains similarity to a tumor-related protein from Nicotiana tabacum gb|U66263 and contains a trypsin and protease inhibitor PF|00197 domain. ESTs gb|AV561824, gb|T44961, gb|H36186, gb|T45060, gb|N38006, gb|F19847 come from this gene [Arabidopsis thaliana] gi|12083240|gb|AAG48779.1|AF332416_1 putative lemir (miraculin) protein [Arabidopsis thaliana] gi|13899081|gb|AAK48962.1|AF370535_1 Unknown protein [Arabidopsis thaliana] gi|15294166|gb|AAK95260.1|AF410274_1 At1g17860/F2H15_8 [Arabidopsis thaliana] gi|20148401|gb|AAM10091.1| unknown protein [Arabidopsis thaliana] gi|20453293|gb|AAM19885.1| At1g17860/F2H15_8 [Arabidopsis thaliana] gi|332191524|gb|AEE29645.1| kunitz type trypsin and protease inhibitor domain-containing protein [Arabidopsis thaliana] Length = 196 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/62 (43%), Positives = 44/62 (70%) Frame = +1 Query: 130 LSHFDELAQRWFVTSGGIEGNPSRQTLDNWFKIEEHAITKVCIKNIHKSIQICPNVYNYC 309 L++FDE ++WF+++ G+EGNP ++T+DNWFKI++ + +K I+ CP V N+C Sbjct: 112 LANFDETTKQWFISTCGVEGNPGQKTVDNWFKIDK-------FEKDYK-IRFCPTVCNFC 163 Query: 310 KV 315 KV Sbjct: 164 KV 165 >gb|AFK41478.1| unknown [Medicago truncatula] Length = 213 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = +1 Query: 103 STHKSEIN*LSHFDELAQRWFVTSGGIEGNPSRQTLDNWFKIEEHAITKVCIKNIHKSIQ 282 S +S I L FD +WFVT+GG+ GNP + T+DNWFKIE++ ++ +K + Sbjct: 119 SCEESTIWTLDDFDSSTGQWFVTTGGVLGNPGKDTVDNWFKIEKY-------EDDYKFV- 170 Query: 283 ICPNVYNYCKV 315 CP V N+CKV Sbjct: 171 FCPTVCNFCKV 181 >ref|XP_003620188.1| Miraculin [Medicago truncatula] gi|355495203|gb|AES76406.1| Miraculin [Medicago truncatula] Length = 213 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/71 (43%), Positives = 44/71 (61%) Frame = +1 Query: 103 STHKSEIN*LSHFDELAQRWFVTSGGIEGNPSRQTLDNWFKIEEHAITKVCIKNIHKSIQ 282 S +S I L FD +WFVT+GG+ GNP + T+DNWFKIE++ ++ +K + Sbjct: 119 SCEESTIWTLDDFDSSTGQWFVTTGGVLGNPGKDTVDNWFKIEKY-------EDDYKFV- 170 Query: 283 ICPNVYNYCKV 315 CP V N+CKV Sbjct: 171 FCPTVCNFCKV 181 >ref|NP_001238098.1| uncharacterized protein LOC100306134 precursor [Glycine max] gi|255627649|gb|ACU14169.1| unknown [Glycine max] Length = 214 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/70 (41%), Positives = 41/70 (58%) Frame = +1 Query: 103 STHKSEIN*LSHFDELAQRWFVTSGGIEGNPSRQTLDNWFKIEEHAITKVCIKNIHKSIQ 282 S +S + L FD+ +WFVT+GG+ GNP + T+DNWFKIEE+ + + Sbjct: 120 SCSESTVWKLDAFDDSTGQWFVTTGGVLGNPGKDTIDNWFKIEEY--------DDDYKLV 171 Query: 283 ICPNVYNYCK 312 CP V N+CK Sbjct: 172 FCPTVCNFCK 181