BLASTX nr result
ID: Aconitum21_contig00004263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00004263 (1800 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511601.1| ubiquitin-protein ligase, putative [Ricinus ... 45 4e-06 ref|XP_004133782.1| PREDICTED: protein ARABIDILLO 1-like [Cucumi... 42 7e-06 ref|XP_004170976.1| PREDICTED: protein ARABIDILLO 1-like, partia... 42 7e-06 >ref|XP_002511601.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223548781|gb|EEF50270.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 920 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +3 Query: 180 GFTDCMTIYVFALGNVVSLRFISVAETKNINW 275 GF DC+ + ALGNVVS+RF+SVA T N+ W Sbjct: 211 GFLDCLNVDEVALGNVVSVRFLSVAGTSNMKW 242 Score = 33.9 bits (76), Expect(2) = 4e-06 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +2 Query: 275 DFNSCAILKLMSSAQSFKVLYPLNCSVLE 361 D A+ +L+SS+ S KVL LNCSVLE Sbjct: 264 DIGPTAVSRLLSSSHSLKVLCALNCSVLE 292 >ref|XP_004133782.1| PREDICTED: protein ARABIDILLO 1-like [Cucumis sativus] Length = 918 Score = 42.4 bits (98), Expect(2) = 7e-06 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = +3 Query: 180 GFTDCMTIYVFALGNVVSLRFISVAETKNINW 275 GF DC I ALGNV S+RF+SVA T N+ W Sbjct: 211 GFIDCFNIDEMALGNVSSVRFLSVAGTSNMKW 242 Score = 35.4 bits (80), Expect(2) = 7e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 275 DFNSCAILKLMSSAQSFKVLYPLNCSVLE 361 D A+ +LMSS+QS KVL NCSVLE Sbjct: 264 DIGPVAVSRLMSSSQSLKVLCAFNCSVLE 292 >ref|XP_004170976.1| PREDICTED: protein ARABIDILLO 1-like, partial [Cucumis sativus] Length = 574 Score = 42.4 bits (98), Expect(2) = 7e-06 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = +3 Query: 180 GFTDCMTIYVFALGNVVSLRFISVAETKNINW 275 GF DC I ALGNV S+RF+SVA T N+ W Sbjct: 211 GFIDCFNIDEMALGNVSSVRFLSVAGTSNMKW 242 Score = 35.4 bits (80), Expect(2) = 7e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 275 DFNSCAILKLMSSAQSFKVLYPLNCSVLE 361 D A+ +LMSS+QS KVL NCSVLE Sbjct: 264 DIGPVAVSRLMSSSQSLKVLCAFNCSVLE 292