BLASTX nr result
ID: Aconitum21_contig00001385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00001385 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283211.1| PREDICTED: DAG protein, chloroplastic isofor... 87 1e-15 ref|XP_004160274.1| PREDICTED: DAG protein, chloroplastic-like [... 84 1e-14 ref|XP_004151975.1| PREDICTED: DAG protein, chloroplastic-like [... 84 1e-14 ref|XP_002889867.1| hypothetical protein ARALYDRAFT_471280 [Arab... 84 1e-14 ref|XP_002518590.1| DAG protein, chloroplast precursor, putative... 84 1e-14 >ref|XP_002283211.1| PREDICTED: DAG protein, chloroplastic isoform 1 [Vitis vinifera] gi|359493924|ref|XP_003634693.1| PREDICTED: DAG protein, chloroplastic isoform 2 [Vitis vinifera] Length = 229 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 118 SSSNEPRETILLPGCDYNHWLIVMEFPKDPAPTREQMID 2 SSSNEPRETI+LPGCDYNHWLIVMEFPKDPAPTREQMID Sbjct: 67 SSSNEPRETIMLPGCDYNHWLIVMEFPKDPAPTREQMID 105 >ref|XP_004160274.1| PREDICTED: DAG protein, chloroplastic-like [Cucumis sativus] Length = 147 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 118 SSSNEPRETILLPGCDYNHWLIVMEFPKDPAPTREQMID 2 SSSNE RETI+LPGCDYNHWLIVMEFPKDPAPTREQMID Sbjct: 66 SSSNEQRETIMLPGCDYNHWLIVMEFPKDPAPTREQMID 104 >ref|XP_004151975.1| PREDICTED: DAG protein, chloroplastic-like [Cucumis sativus] Length = 230 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 118 SSSNEPRETILLPGCDYNHWLIVMEFPKDPAPTREQMID 2 SSSNE RETI+LPGCDYNHWLIVMEFPKDPAPTREQMID Sbjct: 68 SSSNEQRETIMLPGCDYNHWLIVMEFPKDPAPTREQMID 106 >ref|XP_002889867.1| hypothetical protein ARALYDRAFT_471280 [Arabidopsis lyrata subsp. lyrata] gi|297335709|gb|EFH66126.1| hypothetical protein ARALYDRAFT_471280 [Arabidopsis lyrata subsp. lyrata] Length = 232 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 118 SSSNEPRETILLPGCDYNHWLIVMEFPKDPAPTREQMID 2 SSSNE RETI+LPGCDYNHWLIVMEFPKDPAPTREQMID Sbjct: 71 SSSNEQRETIMLPGCDYNHWLIVMEFPKDPAPTREQMID 109 >ref|XP_002518590.1| DAG protein, chloroplast precursor, putative [Ricinus communis] gi|223542435|gb|EEF43977.1| DAG protein, chloroplast precursor, putative [Ricinus communis] Length = 226 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 118 SSSNEPRETILLPGCDYNHWLIVMEFPKDPAPTREQMID 2 SSSNE RETI+LPGCDYNHWLIVMEFPKDPAPTREQMID Sbjct: 64 SSSNESRETIMLPGCDYNHWLIVMEFPKDPAPTREQMID 102