BLASTX nr result
ID: Aconitum21_contig00001163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum21_contig00001163 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communi... 156 2e-36 ref|XP_002509748.1| Osmotin precursor, putative [Ricinus communi... 154 5e-36 gb|AAK59278.1|AF378574_1 thaumatin-like protein [Sambucus nigra] 154 9e-36 gb|AAK59276.1|AF378572_1 thaumatin-like protein [Sambucus nigra] 154 9e-36 gb|AAK59275.1|AF378571_1 thaumatin-like protein [Sambucus nigra] 152 3e-35 >ref|XP_002509749.1| Osmotin precursor, putative [Ricinus communis] gi|223549648|gb|EEF51136.1| Osmotin precursor, putative [Ricinus communis] Length = 225 Score = 156 bits (394), Expect = 2e-36 Identities = 65/76 (85%), Positives = 68/76 (89%) Frame = -3 Query: 456 GQCPAQLRAPGGCNNPCTVFRTNEYCCTNGPGSCRPTDFSRFFKTRCPDAYSYPQDDPTS 277 GQCPAQL+APGGCNNPCTVF+TNEYCCTNG GSC PT FS+FFK RCPDAYSYPQDDPTS Sbjct: 150 GQCPAQLKAPGGCNNPCTVFKTNEYCCTNGQGSCGPTTFSKFFKNRCPDAYSYPQDDPTS 209 Query: 276 TFTCTSGGNYRVVFCP 229 TFTC G NYRV FCP Sbjct: 210 TFTCPGGTNYRVTFCP 225 >ref|XP_002509748.1| Osmotin precursor, putative [Ricinus communis] gi|223549647|gb|EEF51135.1| Osmotin precursor, putative [Ricinus communis] Length = 225 Score = 154 bits (390), Expect = 5e-36 Identities = 64/76 (84%), Positives = 69/76 (90%) Frame = -3 Query: 456 GQCPAQLRAPGGCNNPCTVFRTNEYCCTNGPGSCRPTDFSRFFKTRCPDAYSYPQDDPTS 277 GQCPA+L+APGGCNNPCTVF+TNEYCCTNG GSC PT FS+FFK RCPDAYSYPQDDP+S Sbjct: 150 GQCPAELKAPGGCNNPCTVFKTNEYCCTNGQGSCGPTTFSKFFKDRCPDAYSYPQDDPSS 209 Query: 276 TFTCTSGGNYRVVFCP 229 TFTC SG NYRV FCP Sbjct: 210 TFTCPSGTNYRVTFCP 225 >gb|AAK59278.1|AF378574_1 thaumatin-like protein [Sambucus nigra] Length = 224 Score = 154 bits (388), Expect = 9e-36 Identities = 64/75 (85%), Positives = 69/75 (92%) Frame = -3 Query: 453 QCPAQLRAPGGCNNPCTVFRTNEYCCTNGPGSCRPTDFSRFFKTRCPDAYSYPQDDPTST 274 +CPA+LRAPGGCNNPCTVF NEYCCT+GPGSC+PTDFSRFFKTRCP +YSYPQDDPTS Sbjct: 150 ECPAELRAPGGCNNPCTVFPRNEYCCTDGPGSCQPTDFSRFFKTRCPTSYSYPQDDPTSL 209 Query: 273 FTCTSGGNYRVVFCP 229 FTC SG NYRVVFCP Sbjct: 210 FTCPSGTNYRVVFCP 224 >gb|AAK59276.1|AF378572_1 thaumatin-like protein [Sambucus nigra] Length = 200 Score = 154 bits (388), Expect = 9e-36 Identities = 64/75 (85%), Positives = 69/75 (92%) Frame = -3 Query: 453 QCPAQLRAPGGCNNPCTVFRTNEYCCTNGPGSCRPTDFSRFFKTRCPDAYSYPQDDPTST 274 +CPA+LRAPGGCNNPCTVF NEYCCT+GPGSC+PTDFSRFFKTRCP +YSYPQDDPTS Sbjct: 126 ECPAELRAPGGCNNPCTVFPRNEYCCTDGPGSCQPTDFSRFFKTRCPTSYSYPQDDPTSL 185 Query: 273 FTCTSGGNYRVVFCP 229 FTC SG NYRVVFCP Sbjct: 186 FTCPSGTNYRVVFCP 200 >gb|AAK59275.1|AF378571_1 thaumatin-like protein [Sambucus nigra] Length = 226 Score = 152 bits (384), Expect = 3e-35 Identities = 64/76 (84%), Positives = 68/76 (89%) Frame = -3 Query: 456 GQCPAQLRAPGGCNNPCTVFRTNEYCCTNGPGSCRPTDFSRFFKTRCPDAYSYPQDDPTS 277 GQCP +LRAPGGCNNPCTV+RTNEYCCTNG G+C PT+FSRFFK RC DAYSYPQDDPTS Sbjct: 151 GQCPNELRAPGGCNNPCTVYRTNEYCCTNGQGTCGPTNFSRFFKERCRDAYSYPQDDPTS 210 Query: 276 TFTCTSGGNYRVVFCP 229 TFTC G NYRVVFCP Sbjct: 211 TFTCPGGTNYRVVFCP 226