BLASTX nr result
ID: Achyranthes22_contig00020097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00020097 (252 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q96419.1|TRXH_FAGES RecName: Full=Thioredoxin H-type; Short=T... 59 5e-07 ref|XP_006403964.1| hypothetical protein EUTSA_v10010795mg [Eutr... 59 7e-07 gb|AFY26881.1| thioredoxin [Ipomoea batatas] 59 9e-07 gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] 58 1e-06 gb|ABB53600.1| thioredoxin h [Eucalyptus grandis] 58 1e-06 ref|XP_002894007.1| thioredoxin H-type 5 [Arabidopsis lyrata sub... 57 2e-06 gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas] 57 2e-06 sp|P68176.1|TRXH_BRAOL RecName: Full=Thioredoxin H-type; Short=T... 57 3e-06 ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819... 57 3e-06 ref|XP_006305932.1| hypothetical protein CARUB_v10011156mg [Caps... 57 3e-06 gb|AAG35777.1|AF273844_1 thioredoxin-h-like protein 1 [Brassica ... 57 3e-06 pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Ar... 57 3e-06 sp|O64432.1|TRXH_BRACM RecName: Full=Thioredoxin H-type; Short=T... 57 3e-06 gb|ADU56183.1| thioredoxin H-type [Jatropha curcas] 57 3e-06 ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb... 57 3e-06 ref|NP_001238579.1| uncharacterized protein LOC100499701 [Glycin... 57 3e-06 gb|ACI31202.1| TRX [Salvia miltiorrhiza] 57 3e-06 gb|EXC35509.1| Thioredoxin H-type [Morus notabilis] 56 4e-06 gb|EMJ27315.1| hypothetical protein PRUPE_ppa013299mg [Prunus pe... 56 4e-06 gb|AFP49340.1| thioredoxin h [Olea europaea] 56 4e-06 >sp|Q96419.1|TRXH_FAGES RecName: Full=Thioredoxin H-type; Short=Trx-H gi|1620905|dbj|BAA13524.1| thioredoxin [Fagopyrum esculentum] Length = 116 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +1 Query: 148 AEVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 A+VIACH+V WNE+ K+K+S K++VIDFTASWC Sbjct: 5 AQVIACHTVQEWNEKFQKAKDSGKLIVIDFTASWC 39 >ref|XP_006403964.1| hypothetical protein EUTSA_v10010795mg [Eutrema salsugineum] gi|557105083|gb|ESQ45417.1| hypothetical protein EUTSA_v10010795mg [Eutrema salsugineum] Length = 152 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/45 (57%), Positives = 33/45 (73%), Gaps = 4/45 (8%) Frame = +1 Query: 130 REREKMA----EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 R+R KMA VIACH+V+ WNEQ+ K +S +VV+DFTASWC Sbjct: 34 RKRSKMAAEEGNVIACHTVESWNEQLQKGNDSKTLVVVDFTASWC 78 >gb|AFY26881.1| thioredoxin [Ipomoea batatas] Length = 122 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VIACH+VDHW EQ K E+ K+VV+DFTASWC Sbjct: 11 QVIACHTVDHWKEQFAKGVETKKLVVVDFTASWC 44 >gb|EOX90950.1| Thioredoxin H-type 1, H1,TRX1 [Theobroma cacao] Length = 118 Score = 57.8 bits (138), Expect = 1e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VI CH+V+ WNEQ+ K ES K+VV+DFTASWC Sbjct: 7 QVIGCHTVESWNEQLQKGNESKKLVVVDFTASWC 40 >gb|ABB53600.1| thioredoxin h [Eucalyptus grandis] Length = 117 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VI+CHS + W+EQI KS ES+K+VV+DFTASWC Sbjct: 6 QVISCHSAESWSEQIAKSNESDKLVVVDFTASWC 39 >ref|XP_002894007.1| thioredoxin H-type 5 [Arabidopsis lyrata subsp. lyrata] gi|297339849|gb|EFH70266.1| thioredoxin H-type 5 [Arabidopsis lyrata subsp. lyrata] Length = 118 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 EVIACH+V+ WNE++ ++ ES K++VIDFTASWC Sbjct: 6 EVIACHTVEVWNEKVKEANESKKLIVIDFTASWC 39 >gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas] Length = 123 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VIACH+VDHW EQ K E+ ++VV+DFTASWC Sbjct: 11 QVIACHTVDHWKEQFAKGVETKRLVVVDFTASWC 44 >sp|P68176.1|TRXH_BRAOL RecName: Full=Thioredoxin H-type; Short=Trx-H; AltName: Full=Pollen coat protein gi|57014140|sp|P68177.1|TRXH1_BRANA RecName: Full=Thioredoxin H-type 1; Short=Trx-H-1 gi|1122396|emb|CAA61908.1| pollen coat protein [Brassica oleracea] gi|1401220|gb|AAB53694.1| thioredoxin-h-like-1 [Brassica napus] Length = 123 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 EVIACH+V+ WN ++ +KESNK++VIDFTA WC Sbjct: 12 EVIACHTVEDWNNKLKAAKESNKLIVIDFTAVWC 45 >ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819804|ref|XP_002877785.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|267122|sp|P29448.1|TRXH1_ARATH RecName: Full=Thioredoxin H1; Short=AtTrxh1; AltName: Full=Thioredoxin 1; Short=AtTRX1 gi|16552|emb|CAA78462.1| Thioredoxin H [Arabidopsis thaliana] gi|1388080|gb|AAC49354.1| thioredoxin h [Arabidopsis thaliana] gi|6562255|emb|CAB62625.1| thioredoxin h [Arabidopsis thaliana] gi|21617958|gb|AAM67008.1| thioredoxin h [Arabidopsis thaliana] gi|297323623|gb|EFH54044.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|332645218|gb|AEE78739.1| thioredoxin H1 [Arabidopsis thaliana] Length = 114 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VIACH+V+ WNEQ+ K+ ES +VV+DFTASWC Sbjct: 7 QVIACHTVETWNEQLQKANESKTLVVVDFTASWC 40 >ref|XP_006305932.1| hypothetical protein CARUB_v10011156mg [Capsella rubella] gi|482574643|gb|EOA38830.1| hypothetical protein CARUB_v10011156mg [Capsella rubella] Length = 118 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 EVIACH++D WNE++ + ES K++VIDFTASWC Sbjct: 6 EVIACHTLDVWNEKVKDANESKKLIVIDFTASWC 39 >gb|AAG35777.1|AF273844_1 thioredoxin-h-like protein 1 [Brassica oleracea var. alboglabra] Length = 116 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 EVIACH+V+ WN ++ +KESNK++VIDFTA WC Sbjct: 5 EVIACHTVEDWNNKLKAAKESNKLIVIDFTAVWC 38 >pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VIACH+V+ WNEQ+ K+ ES +VV+DFTASWC Sbjct: 17 QVIACHTVETWNEQLQKANESKTLVVVDFTASWC 50 >sp|O64432.1|TRXH_BRACM RecName: Full=Thioredoxin H-type; Short=Trx-H gi|3062793|dbj|BAA25681.1| Thioredoxin [Brassica rapa] Length = 123 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 EVIACH+V+ WN ++ +KESNK++VIDFTA WC Sbjct: 12 EVIACHTVEDWNNKLKAAKESNKLIVIDFTAVWC 45 >gb|ADU56183.1| thioredoxin H-type [Jatropha curcas] Length = 118 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VIACH+V+ WNEQ+ K KES ++V+DFTA+WC Sbjct: 6 QVIACHTVEAWNEQLEKGKESKTLIVVDFTATWC 39 >ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb|ABV71991.1| thioredoxin h1 [Glycine max] Length = 120 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/34 (58%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VI+CH+V+ WN+Q+ K ES K++V+DFTASWC Sbjct: 9 QVISCHTVEEWNDQLQKGNESKKLIVVDFTASWC 42 >ref|NP_001238579.1| uncharacterized protein LOC100499701 [Glycine max] gi|255625907|gb|ACU13298.1| unknown [Glycine max] Length = 120 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/34 (58%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VI+CH+VD WN+Q+ K +S K++V+DFTASWC Sbjct: 9 QVISCHTVDAWNDQLQKGNQSKKLIVVDFTASWC 42 >gb|ACI31202.1| TRX [Salvia miltiorrhiza] Length = 122 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VI+CHSVD W E K +SNK+VV+DFTASWC Sbjct: 8 QVISCHSVDEWKEHFQKGVDSNKLVVVDFTASWC 41 >gb|EXC35509.1| Thioredoxin H-type [Morus notabilis] Length = 119 Score = 56.2 bits (134), Expect = 4e-06 Identities = 20/34 (58%), Positives = 29/34 (85%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +V++CH+++ WNEQ+ K ES K+VV+DFTASWC Sbjct: 7 QVVSCHTLEAWNEQLQKGNESKKLVVVDFTASWC 40 >gb|EMJ27315.1| hypothetical protein PRUPE_ppa013299mg [Prunus persica] Length = 130 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/50 (48%), Positives = 32/50 (64%) Frame = +1 Query: 103 HLPHNFAKEREREKMAEVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 H+ + R K + ++A HS D WN N SKESNK++VIDFTA+WC Sbjct: 7 HIQDYSDDDSSRGKKSRIMAFHSKDQWNTHFNASKESNKLMVIDFTATWC 56 >gb|AFP49340.1| thioredoxin h [Olea europaea] Length = 123 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +1 Query: 151 EVIACHSVDHWNEQINKSKESNKVVVIDFTASWC 252 +VI CHSVD W E NK E+ K+VVIDFTASWC Sbjct: 7 QVIGCHSVDQWKENFNKGIETKKLVVIDFTASWC 40